Springer Springer Aug 2002 (414 results)
Language: English
Published by Springer Nature B.V. Aug 2002, 2002
Series: Book 42 of 323 - International Series in Operations Research & Management Science
- Hardcover
Seller: AHA-BUCH GmbH, Einbeck, GermanyAHA-BUCH GmbH
Contact seller5-star sellerCondition: New
£ 142.20
£ 53.10 shippingShips from Germany to U.S.A.Quantity: 1 available
Buch. Condition: Neu. Neuware - Potential Function Methods For Approximately Solving Linear Programming Problems breaks new ground in linear programming theory. The book draws on the research developments in three broad areas: linear and integer programming, numerical analysis, and the computational architectures which enable sp…eedy, high-level algorithm design. During the last ten years, a new body of research within the field of optimization research has emerged, which seeks to develop good approximation algorithms for classes of linear programming problems. This work both has roots in fundamental areas of mathematical programming and is also framed in the context of the modern theory of algorithms. The result of this work, in which Daniel Bienstock has been very much involved, has been a family of algorithms with solid theoretical foundations and with growing experimental success. This book will examine these algorithms, starting with some of the very earliest examples, and through the latest theoretical and computational developments.
Language: English
Published by Springer Nature B.V. Aug 2002, 2002
Series: Book 84 of 260 - The Springer International Series in Engineering and Computer Science
- Hardcover
Seller: AHA-BUCH GmbH, Einbeck, GermanyAHA-BUCH GmbH
Contact seller5-star sellerCondition: New
£ 143.91
£ 53.37 shippingShips from Germany to U.S.A.Quantity: 2 available
Buch. Condition: Neu. Neuware - Mining Spatio-Temporal Information Systems, an edited volume is composed of chapters from leading experts in the field of Spatial-Temporal Information Systems and addresses the many issues in support of modeling, creation, querying, visualizing and mining. Mining Spatio-Temporal Information System…s is intended to bring together a coherent body of recent knowledge relating to STIS data modeling, design, implementation and STIS in knowledge discovery. In particular, the reader is exposed to the latest techniques for the practical design of STIS, essential for complex query processing. Mining Spatio-Temporal Information Systems is structured to meet the needs of practitioners and researchers in industry and graduate-level students in Computer Science.
- Hardcover
Seller: AHA-BUCH GmbH, Einbeck, GermanyAHA-BUCH GmbH
Contact seller5-star sellerCondition: New
£ 143.91
£ 56.25 shippingShips from Germany to U.S.A.Quantity: 2 available
Buch. Condition: Neu. Neuware - This book shows readers how to get the most out of C# using Object Orientation. The author takes a hands-on approach to learning C# and object orientation, using lots of worked examples. The text provides an ideal base from which to start programming. After introducing the C# language and object o…rientation, John Hunt goes on to explain: how to construct a user interface for a simple editor; how to obtain information on files and directories and how objects can be stored and restored using serialization.-Presents C# and object-orientation as a coherent whole, using one to strengthen the presentation of the other -Includes lots of complete and worked examples to clarify readers'understanding -The source code for the examples is available at: guide-to-csharp.net -Hunt is a successful Springer author, and this book is written in the same style as his Java for Practitioners.
Language: English
Published by Springer Berlin Heidelberg, Springer Berlin Heidelberg Aug 2002, 2002
- Hardcover
Seller: Wegmann1855, Zwiesel, GermanyWegmann1855
Contact seller5-star sellerCondition: New
£ 189.01
£ 22.25 shippingShips from Germany to U.S.A.Quantity: 1 available
Buch. Condition: Neu. Neuware -The design and the realisation of well defined polymer architectures has become an important goal in macromolecular science. The prerequisite for achieving this goal is the availability of controlled polymerisation reactions. Living anionic polymerisation was the first reaction fulfilling these req…uirements. Cationic polymerisation only came into play when it was realised that it was possible to create an equilibrium between active and dormant species with the fraction of the dormant species being far superior to that of active ones. A corresponding principle applies to controlled radical polymerisation per formed in quite a number of modes such as nitroxide mediated polymerisation (NMP), atom transfer radical polymerisation (ATRP), reversible addition frag mentation chain transfer (RAFT) or catalytic chain transfer (CCT) reactions. All of these variants of controlled radical polymerisation lead to well defined archi tectures with the particular advantage that a much larger number of monomers are suitable and the reaction conditions are much less demanding than those of living ionic polymerisation reactions. Although in controlled radical polymerisation, termination reactions cannot be excluded completely, they are limited in their extent and consequently the mol ecular weight is controlled, the polydispersity index is small and functionalities can be attached to the macromolecules. These features are indicative of the real isation of well defined polymer architectures such as block copolymers, star shaped and comb shaped copolymers.
- Hardcover
Seller: AHA-BUCH GmbH, Einbeck, GermanyAHA-BUCH GmbH
Contact seller5-star sellerCondition: New
£ 189.01
£ 53.50 shippingShips from Germany to U.S.A.Quantity: 1 available
Buch. Condition: Neu. Neuware - The design and the realisation of well defined polymer architectures has become an important goal in macromolecular science. The prerequisite for achieving this goal is the availability of controlled polymerisation reactions. Living anionic polymerisation was the first reaction fulfilling these re…quirements. Cationic polymerisation only came into play when it was realised that it was possible to create an equilibrium between active and dormant species with the fraction of the dormant species being far superior to that of active ones. A corresponding principle applies to controlled radical polymerisation per formed in quite a number of modes such as nitroxide mediated polymerisation (NMP), atom transfer radical polymerisation (ATRP), reversible addition frag mentation chain transfer (RAFT) or catalytic chain transfer (CCT) reactions. All of these variants of controlled radical polymerisation lead to well defined archi tectures with the particular advantage that a much larger number of monomers are suitable and the reaction conditions are much less demanding than those of living ionic polymerisation reactions. Although in controlled radical polymerisation, termination reactions cannot be excluded completely, they are limited in their extent and consequently the mol ecular weight is controlled, the polydispersity index is small and functionalities can be attached to the macromolecules. These features are indicative of the real isation of well defined polymer architectures such as block copolymers, star shaped and comb shaped copolymers.
- Hardcover
Seller: AHA-BUCH GmbH, Einbeck, GermanyAHA-BUCH GmbH
Contact seller5-star sellerCondition: New
£ 216.40
£ 53.78 shippingShips from Germany to U.S.A.Quantity: 2 available
Buch. Condition: Neu. Neuware - Communication Systems: The State of the Art captures the depth and breadth of the field of communication systems: -Architectures and Protocols for Distributed Systems; -Network and Internetwork Architectures; -Performance of Communication Systems; -Internet Applications Engineering; -Management of… Networks and Distributed Systems; -Smart Networks; -Wireless Communications; -Communication Systems for Developing Countries; -Photonic Networking; -Communication Systems in Electronic Commerce. This volume's scope and authority present a rare opportunity for people in many different fields to gain a practical understanding of where the leading edge in communication systems lies today-and where it will be tomorrow.
- Hardcover
Seller: AHA-BUCH GmbH, Einbeck, GermanyAHA-BUCH GmbH
Contact seller5-star sellerCondition: New
£ 216.40
£ 54.92 shippingShips from Germany to U.S.A.Quantity: 2 available
Buch. Condition: Neu. Neuware - During his term as President of APA-LS/Division 41, James Ogloff organized a comprehensive program of research reviews in the area of the law and psychology. Taking Psychology and Law into the Twenty-First Century is the product of that program. In these pages top scholars contribute chapters cove…ring a wide range of topics including jurisprudence, competency, children, forensic risk assessment, eyewitness testimony, jurors and juries, lawsuits, and civil law. Also included is an introductory chapter by the editor. The result is a unique and comprehensive treatment of the issues at the confluence of these disciplines.
- Softcover
Seller: AHA-BUCH GmbH, Einbeck, GermanyAHA-BUCH GmbH
Contact seller5-star sellerCondition: New
£ 32.96
£ 26.15 shippingShips from Germany to U.S.A.Quantity: 1 available
Taschenbuch. Condition: Neu. Neuware - L'Anatomia Comparata dei Vertebrati è stata sempre tradizionalmente studiata su libri di testo corredati da una iconografia che, per ragioni didattiche, era costituita da disegni schematici di organi e sistemi, certamente molto utili per fornire un'idea generale della struttura anatomica e…della funzionalità, ma avulsi dal contesto complessivo del piano organizzativo del corpo dell'animale. Di conseguenza, raramente lo studente aveva modo di rendersi conto della reale morfologia macroscopica degli organi studiati e della loro reciproca disposizione. Questo atlante vuole colmare, almeno in parte, questa lacuna fornendo una serie di immagini reali di Anatomia topografica di animali, utilizzati come modelli delle più importanti classi di Vertebrati. La pubblicazione, rivolta principalmente agli studenti dei corsi di Laurea in Scienze Biologiche e Scienze Naturali, potrà essere utile a tutti coloro che per dovere o per diletto si occupano di Anatomia dei Vertebrati.
- Hardcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 21.73
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Time is fundamental to our experience, but remains mysterious. This book shows how philosophers and scientists have tried to grapple with this most extraordinary of ordinary phenomena. From the attempts of early astronomers to reconcile so…lar and lunar and terrestrial reckonings, to the huge expansions and contractions of time consciousness brought on by scientists as diverse as Newton, Darwin, and Einstein, this book shows how time is as much a matter of human choice as it is a matter of scientific precision. 196 pp. Englisch.
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 27.83
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This comprehensive guide to the poetry and letters of John Keats offers a highly readable and detailed textual analysis of the themes and techniques of his work. Blades assesses all the major writing - including the narratives and t…he great odes - and goes on to examine the context of the verse through a survey of the poet's letters and an examination of the key features of nineteenth century Romanticism. This lively and imaginative study concludes with a discussion of some of the most influential critical responses to Keats's work. Englisch.
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 34.96
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Interest in progressive education and feminist pedagogy has gained a significant following in current educational reform circles. Founding Mothers and Others examines the female founders of progressive schools and other female educa…tional leaders in the early twentieth century and their schools or educational movements. All of the women led remarkable lives and their legacies are embedded in education today. The book examines the lessons to be learned from their work and their lives. The book also analyzes whether their leadership styles support contemporary feminist theories of leadership that argue women administrators tend to be more inclusive, democratic, and caring than male administrators. Through an examination of these women, this book looks critically at the ways in which the leaders' administrative styles and behaviors lend support to feminist claims. 268 pp. Englisch.
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 37.76
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -A morphism of algebraic varieties (over a field characteristic 0) is monomial if it can locally be represented in e'tale neighborhoods by a pure monomial mappings. The book gives proof that a dominant morphism from a nonsingular 3-f…old X to a surface S can be monomialized by performing sequences of blowups of nonsingular subvarieties of X and S.The construction is very explicit and uses techniques from resolution of singularities. A research monograph in algebraic geometry, it addresses researchers and graduate students. 248 pp. Englisch.
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 39.75
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Was there an Irish Revolution, and - if so - what kind of revolution was it What motivated revolutionaries and those who supported them How was the war fought and ended What have been the repercussions for unionists, women and moder…n Irish politics These questions are here addressed by leading historians of the period through both detailed assessments of specific incidents and wide-ranging analysis of key themes. The Irish Revolution, 1913-1923 provides the most up-to-date answers to, and debate on, the fundamental questions relating to this formative period in Irish history.Clear coverage of the historiography and a detailed chronology make this book ideal for classroom use. The Irish Revolution is essential reading for students and scholars of modern Ireland, and for all those interested in the study of revolution. 272 pp. Englisch.
- Hardcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.21
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This book offers an introductory course in model theory emphasizing connections to algebra. It will be an appropriate introduction both for graduate students interested in advanced work in model theory and for students and researchers in l…ogic or algebra who want to learn the basic results and themes of model theory. In the end, the reader will have a firm background in model theory and be well motivated and well prepared for more advanced treatments like Pillay's 'Geometric Model Theory' or Buechler's 'Essential Stability Theory.'While some familiarity at the undergraduate level with mathematical logic would be helpful, it is not assumed. The author assumes familiarity with algebra at the first-year graduate level. 356 pp. Englisch.
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Communities across America were thrown into upheaval during the 1960s, when thousands of young people began to publicly question the status quo, particularly in terms of race, youth, and gender. As grassroots social movements sprung… up on college campuses (and often spread to surrounding towns) where participants debated race, the role of government, Vietnam, feminism, the Cold War, and other issues of the day, Americans that supported the status quo joined forces to oppose the activists and lend their own voices to the debate on the meaning of citizenship and patriotism. Monhollon uncovers the voices of ordinary people on all sides of the political spectrum in the university town of Lawrence, Kansas, and reveals how Americans from a range of ideological and political perspectives responded to and tried to resolve political and social conflict in the 1960s. 284 pp. Englisch.
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This volume of the Lecture Notes in Computer Science series provides a c- prehensive, state-of-the-art survey of recent advances in string processing and information retrieval. It includes invited and research papers presented at th…e 9th International Symposium on String Processing and Information Retrieval, SPIRE2002, held in Lisbon, Portugal. SPIREhas its origins in the South Am- ican Workshop on String Processing which was rst held in Belo Horizonte, Brazil, in 1993. Starting in 1998, the focus of the workshop was broadened to include the area of information retrieval due to its increasing relevance and its inter-relationship with the area of string processing. The call for papers for SPIRE2002 resulted in the submission of 54 papers from researchers around the world. Of these, 19 were selected for inclusion in the program (an acceptance rate of 35%). In addition, the Program Committee decided to accept six other papers, considered as describing interesting ongoing research, in the form of short papers. The authors of these 25 papers came from 18 di erent countries (Argentina, Australia, Brazil, Canada, Czech Republic, Chile, Colombia, Finland, France, Germany, Japan, Italy, Mexico, Saudi Arabia, Switzerland, Spain, United Kingdom, and USA). 356 pp. Englisch.
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This volume contains lectures given at the Saint-Flour Summer School of Probability Theory during the period 8th-24th July, 1999. We thank the authors for all the hard work they accomplished. Their lectures are a work of reference i…n their domain. The School brought together 85 participants, 31 of whom gave a lecture concerning their research work. At the end of this volume you will find the list of participants and their papers. Finally, to facilitate research concerning previous schools we give here the number of the volume of 'Lecture Notes' where they can be found: Lecture Notes in Mathematics 1975: n ° 539- 1971: n ° 307- 1973: n ° 390- 1974: n ° 480- 1979: n ° 876- 1976: n ° 598- 1977: n ° 678- 1978: n ° 774- 1980: n ° 929- 1981: n ° 976- 1982: n ° 1097- 1983: n ° 1117- 1988: n ° 1427- 1984: n ° 1180- 1985-1986 et 1987: n ° 1362- 1989: n ° 1464- 1990: n ° 1527- 1991: n ° 1541- 1992: n ° 1581- 1993: n ° 1608- 1994: n ° 1648- 1995: n ° 1690- 1996: n ° 1665- 1997: n ° 1717- 1998: n ° 1738- Lecture Notes in Statistics 1971: n ° 307- Table of Contents Part I Erwin Bolthausen: Large Deviations and Interacting Random Walks 1 On the construction of the three-dimensional polymer measure. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 2 Self-attracting random walks. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 3 One-dimensional pinning-depinning transitions. . . . . . . . . . . 105 References. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 484 pp. Englisch.
Language: English
Published by Springer Berlin Heidelberg, Springer Berlin Heidelberg Aug 2002, 2002
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -For the rst time four workshops have been held in conjunction with the 8th Object-Oriented Information Systems conference, OOIS 2002, to encourage - teraction between researchers and practitioners. Workshop topics are, of course, in…line with the conference's scienti c scope and provide a forum for groups of researchers and practitioners to meet together more closely and to exchange opinions and advanced ideas, and to share preliminary results on focused issues in an atmosphere that fosters interaction and problem solving. The conference hosted four one-day workshops. The four selected workshops were fully in the spirit of a workshop session hosted by a main conference. Indeed, OOIS deals with all the topics related to the use of object-oriented techniques for the development of information systems. The four workshops are very speci c and contribute to enlarging the spectrum of the more general topics treated in the main conference. The rst workshop focused on a very speci c and key c- cept of object-oriented development, the specialization/generalization hierarchy. The second one explored the use of 'non-traditional' approaches (at the edge of object-oriented techniques, such as aspects, AI, etc.) to improve reuse. The third workshop dealt with optimization in Web-based information systems. And nally the fourth workshop investigated issues related to model-driven software development. 336 pp. Englisch.
- Hardcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Included here is a discussion of the pathophysiological aspects and risks of laparoscopic staging (such as trocar metastases) on the basis of international experience. 200 pp. Englisch.
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This book presents refereed and revised papers presented at GREC 2001, the 4th IAPR International Workshop on Graphics Recognition, which took place in Kingston, Ontario, Canada in September 2001. Graphics recognition is a branch of… document image analysis that focuses on the recognition of two-dimensional notations such as engineering drawings, maps, mathematical notation, music notation, tables, and chemical structure diagrams. Due to the growing demand for both o -line and on-line document recognition systems, the eld of graphics recognition has an excitingand promisingfuture. The GREC workshops provide an opportunity for researchers at all levels of experience to share insights into graphics recognition methods. The workshops enjoy strongparticipation from researchers in both industry and academia. They are sponsored by IAPR TC-10, the Technical Committee on Graphics Recog- tion within the International Association for Pattern Recognition. Edited v- umes from the previous three workshops in this series are available as Lecture Notes in Computer Science, Vols. 1072, 1389, and 1941. After the GREC 2001 workshop, authors were invited to submit enhanced versions of their papers for review. Every paper was evaluated by three reviewers. We are grateful to both authors and reviewers for their careful work during this review process. Many of the papers that appear in this volume were thoroughly revised and improved, in response to reviewers' suggestions. 388 pp. Englisch.
Language: English
Published by Springer Berlin Heidelberg, Springer Berlin Heidelberg Aug 2002, 2002
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -This book constitutes the refereed proceedings of the 21st International Conference on Computer Safety, Reliability and Security, SAFECOMP 2002, held in Catania, Italy in September 2002.The 27 revised papers presented together with…3 keynote presentations were carefully reviewed and selected from 69 submissions. The papers are organized in topical sections on human-computer system dependability, human factors, security, dependability assessment, application of formal methods, reliability assessment, design for dependability, and safety assessment. 372 pp. Englisch.
- Hardcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Methods in Nonlinear Integral Equations presents several extremely fruitful methods for the analysis of systems and nonlinear integral equations. They include: fixed point methods (the Schauder and Leray-Schauder principles), variational m…ethods (direct variational methods and mountain pass theorems), and iterative methods (the discrete continuation principle, upper and lower solutions techniques, Newton's method and the generalized quasilinearization method). Many important applications for several classes of integral equations and, in particular, for initial and boundary value problems, are presented to complement the theory. Special attention is paid to the existence and localization of solutions in bounded domains such as balls and order intervals. The presentation is essentially self-contained and leads the reader from classical concepts to current ideas and methods of nonlinear analysis. 236 pp. Englisch.
- Hardcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Molecular Control Mechanisms in Striated Muscle Contraction addresses the molecular mechanisms by which contraction of heart and skeletal muscles is regulated, as well as the modulation of these mechanisms by important (patho)physiological… variables such as ionic composition of the myoplasm and phosphorylations of contractile and regulatory proteins.For the novice, this volume includes chapters that summarize current understanding of excitation-contraction coupling in striated muscles, as well as the compositions and structures myofibrillar thick and thin filaments. For the expert, this volume presents detailed pictures of current understanding of the mechanisms underlying the CA2+ regulation of contraction in heart and skeletal muscles and discusses important directions for future investigation. 484 pp. Englisch.
Language: English
Published by Springer Berlin Heidelberg, Springer Aug 2002, 2002
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The AIMSA conference series was rst conceived in 1984 as a gathering of AI researchersandstudentsfromEasternandCentralEurope.Sincethenthecon- rence has followed a biennial schedule of meetings in Bulgaria, attracting parti- pantsfro…mawidergeographicalarea.Today,20yearson,AIMSAisathoroughly international conference, with contributions from most European countries and some from as far a eld as the United States, Mexico and Brazil. The AIMSA organizers are delighted to present you with another exciting program,coveringmostareasofArti cialIntelligence.Inkeepingwithitsm- sion to inform the research community and excite the commercial sector, AIMSA presents this year two invited contributions from world-leading European rese- chersworkingoncutting-edgeAIresearch:Prof.CaroleGoble,ontheSemantic Web,andProf.DavidHouse,onintegratedspeechandgesturalsynthesis.In addition, we present 26 contributions on topics covering almost all aspects of AIandbringingtogetherbasicandappliedresearch.Oneofthese,byMilos Kova cevi c and his colleagues on Recognition of Common Areas in a Web Page Using a Visualisation Approach was judged by reviewers to be the best s- mitted paper, and duly received the accolade of Best Paper of the Conference, with a special slot devoted to it in the program. As Chair of the Program Committee, I am extremely grateful to those who so generously agreed to apply their expertise and valuable time to reviewing papers for the conference, and for their dedication in getting the best possible job done in what turned out to be a very short period of time. 296 pp. Englisch.
Language: English
Published by Springer Berlin Heidelberg, Springer Berlin Heidelberg Aug 2002, 2002
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Within the last few years Data Warehousing and Knowledge Discovery technology has established itself as a key technology for enterprises that wish to improve the quality of the results obtained from data analysis, decision support,…and the automatic extraction of knowledge from data. The Fourth International Conference on Data Warehousing and Knowledge Discovery (DaWaK 2002) continues a series of successful conferences dedicated to this topic. Its main objective is to bring together researchers and practitioners to discuss research issues and experience in developing and deploying data warehousing and knowledge discovery systems, applications, and solutions. The conference focuses on the logical and physical design of data warehousing and knowledge discovery systems. The scope of the papers covers the most recent and relevant topics in the areas of association rules, clustering, Web mining, security, data mining techniques, data cleansing, applications, data warehouse design and maintenance, and OLAP. These proceedings contain the technical papers selected for presentation at the conference. We received more than 100 papers from over 20 countries, and the program committee finally selected 32 papers. The conference program included one invited talk: 'Text Mining Applications of a Shallow Parser' by Walter Daelemans, Univer- ty of Antwerp, Belgium. We would like to thank the DEXA 2002 Workshop General Chair (Roland Wagner) th and the organizing committee of the 13 International Conference on Database and Expert Systems Applications (DEXA 2002) for their support and their cooperation. 360 pp. Englisch.
Language: English
Published by Springer Berlin Heidelberg, Springer Berlin Heidelberg Aug 2002, 2002
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Thisvolumecontainstheproceedingsofthe 15th International Conference on TheoremProvinginHigherOrderLogics(TPHOLs2002)heldon20 23August 2002inHampton,Virginia,USA. Theconferenceservesasavenueforthep- sentationofworkintheoremprovinginh…igher-orderlogics,andrelatedareas indeduction,formalspeci cation,softwareandhardwareveri cation,andother applications. Eachofthe34paperssubmittedinthefullresearchcategorywasrefereedby atleastthreereviewersfromtheprogramcommitteeorbyareviewerappointed bytheprogramcommittee. Ofthesesubmissions,20paperswereacceptedfor presentationattheconferenceandpublicationinthisvolume. Followingawell-establishedtraditioninthisconferenceseries,TPHOLs2002 alsoo eredavenueforthepresentationofworkinprogress. Fortheworkin progresstrack,shortintroductorytalksweregivenbyresearchers,followedby anopenpostersessionforfurtherdiscussion. Papersacceptedforpresentation inthistrackhavebeenpublishedasConferenceProceedingsCPNASA-2002- 211736. TheorganizerswouldliketothankRickyButlerandG erardHuetforgra- fullyacceptingourinvitationtogivetalksatTPHOLs2002. RickyButlerwas instrumentalintheformationoftheFormalMethodsprogramattheNASA LangleyResearchCenterandhasledthegroupsinceitsbeginnings. TheNASA LangleyFormalMethodsgroup,underRickyButler sguidance,hasfunded, beeninvolvedin,orin uencedmanyformalveri cationprojectsintheUSover morethantwodecades. In1998G erardHuetreceivedtheprestigiousHerbrand Awardforhisfundamentalcontributionstotermrewritingandtheoremproving inhigher-orderlogic,aswellasmanyotherkeycontributionstothe eldof- tomatedreasoning. HeistheoriginatoroftheCoqSystem,underdevelopment atINRIA-Rocquencourt. Dr. Huet scurrentmaininterestiscomputationall- guistics,howeverhisworkcontinuestoin uenceresearchersaroundtheworldin awidespectrumofareasintheoreticalcomputerscience,formalmethods,and softwareengineering. ThevenueoftheTPHOLsconferencetraditionallychangescontinenteach yearinordertomaximizethelikelihoodthatresearchersfromallovertheworld willattend. Startingin1993,theproceedingsofTPHOLsanditspredecessor workshopshavebeenpublishedinthefollowingvolumesoftheSpringer-Verlag LectureNotesinComputerScienceseries: 1993(Canada) 780 1998(Australia)1479 1994(Malta) 859 1999(France) 1690 1995(USA) 971 2000(USA) 1869 1996(Finland)1125 2001(UK) 2152 1997(USA) 1275 VI Preface The2002conferencewasorganizedbyateamfromNASALangleyResearch Center,theICASEInstituteatLangleyResearchCenter,andConcordiaU- versity. FinancialsupportcamefromIntelCorporation. Thesupportofallthese organizationsisgratefullyacknowledged. August2002 V ctorA. Carreno C esarA. Muno z VII Organization TPHOLs2002isorganizedbyNASALangleyandICASEincooperationwith ConcordiaUniversity. Organizing Committee ConferenceChair: V ctorA. Carren o(NASALangley) ProgramChair: C esarA. Muno z(ICASE,NASALaRC) So `eneTahar(ConcordiaUniversity) ProgramCommittee MarkAagaard(Waterloo) MichaelKohlhase(CMU&Saarland) DavidBasin(Freiburg) ThomasKropf(Bosch) V ctorCarren o(NASALangley) TomMelham(Glasgow) Shiu-KaiChin(Syracuse) JStrotherMoore(Texas,Austin) PaulCurzon(Middlesex) C esarMuno z(ICASE,NASALaRC) GillesDowek(INRIA) SamOwre(SRI) HaraldGanzinger(MPISaarbruc ken) ChristinePaulin-Mohring(INRIA) GaneshGopalakrishnan(Utah) LawrencePaulson(Cambridge) JimGrundy(Intel) FrankPfenning(CMU) ElsaGunter(NJIT) KlausSchneider(Karlsruhe) JohnHarrison(Intel) HennySipma(Stanford) DougHowe(Carleton) KonradSlind(Utah) BartJacobs(Nijmegen) DonSyme(Microsoft) PaulJackson(Edinburgh) So `eneTahar(Concordia) SaraKalvala(Warwick) WaiWong(HongKongBaptist) Additional Reviewers OtmaneAit-Mohamed AlfonsGeser HaraldRueß BehzadAkbarpour HanneGottliebsen LeonvanderTorre NancyDay MikeKishinevsky TomasUribe BenDiVito HansdeNivelle Jean-ChristopheFilli atre AndrewPitts Invited Speakers RickyButler(NASALangley) G erardHuet(INRIA) VIII Preface Sponsoring Institutions NASALangley ICASE ConcordiaUniversity INTEL Table of Contents Invited Talks FormalMethodsatNASALangley.
- Hardcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Buch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -Self-contained, and collating for the first time material that has until now only been published in journals - often in Russian - this book will be of interest to functional analysts, especially those with interests in topological vector s…paces, and to algebraists concerned with category theory. The closed graph theorem is one of the corner stones of functional analysis, both as a tool for applications and an object for research. However, some of the spaces which arise in applications and for which one wants closed graph theorems are not of the type covered by the classical closed graph theorem of Banach or its immediate extensions. To remedy this, mathematicians such as Schwartz and De Wilde (in the West) and Rajkov (in the East) have introduced new ideas which have allowed them to establish closed graph theorems suitable for some of the desired applications. In this book, Professor Smirnov uses category theory to provide a very general framework, including the situations discu ssed by De Wilde, Rajkov and others. General properties of the spaces involved are discussed and applications are provided in measure theory, global analysis and differential equations. 232 pp. Englisch.
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The fthFinancialCryptographyconferencewasheldFebruary19 22,2001. Afterhalfadecade,wemovedbeyondourAnguillanoriginstoGrandCayman, BWI. Thevenuechangedbutthefocusoftheprogramremainedtopresentthe bestresearchinsecuringelectronic nancia…ltransactionsandelectronicc- merce. Asinthepastfewyears,mostofthecontributedpapersfocusedonthe technicalcryptographicandsecurityaspectsof nancialcryptography,whilethe nancialaspectsarere ectedprimarilyininvitedtalksandpanels. (Andinthe informaldiscussion. )Thisyear,inadditiontothesubmittedpapers,wehada provocativeinvitedtalkbyRichardRahnonmoneylaunderingaswellaspanels ondigitalrightsmanagementandthebusinessofelectronicvoting. Therewas alsoarumpsession,chairedbyRebeccaWright. Thereweremanyinterestingandmanytechnicallystrongsubmissions. I thanktheprogramcommittee(listedonthenextpage)fortheirhelpinthe di culttaskofchoosingthosepapersthatmadethestrongestcontributionto theconference. WehadadditionalreviewinghelpfromOlivierBaudron,Paul Fahn,JuanGaray,MarkusJakobsson,GuenterKarjoth,PhongNguyen,David Pointcheval,ThomasPornin,SholomRosen,DawnSong,SusanneWetzel,and RebeccaWright. (MyapologiesifIhaveoverlookedanyone. )Iwouldalsoliketo thankGeorgeDavida,theelectronicsubmissionschair,andhisstudent,Dawn MarieGibson,forsettingupandrunningthesubmissionsprocessattheUniv- sityofWisconsin. AnextrabigthankyoutoYairFrankel,whowasalwaysthere withhisexperienceandadvicethatgreatlyimprovedthejobIdidasprogram chair,aswellasmakingitmoreenjoyable. MattFranklinalsoprovidedvaluable advice. Thankstoallthepeoplewhosubmittedpapers,withoutwhichthere wouldbenoprogram. Authorsweregiventheopportunitytorevisetheirpapers followingtheconference. Thesewerecollectedwithoutfurtherreviewandare includedinthisvolume. ThankstogeneralchairStuartHaberfordoingmanythingsthatnoneofthe attendeesnoticedbecausehedidthemsonicely. HewasablyassistedbyHinde tenBerge. ThankstoHarrisMcCoyforhandlinglocalarrangementsandJason CronkformaintainingtheWebsite. ThankstotheIFCAdirectorsforkeeping FCthriving,toAdamShostackforvenuearrangements,andtoBarbFox,the sponsorshipchair. Thankstoour nancialsponsors,whoarelistedonthenext page. SpecialthankstoRayHirschfeldwhoseadvicetomeandtotheothersm- tionedherehasbeeninvaluable. Thanks nallytoattendeeswithoutwhomthere wouldbenoconference. March2001 PaulSyverson VI Preface ProgramCommittee MattBlaze,AT&TLabs-Research YairFrankel,Ecash MattFranklin,UCDavis DavidKravitz,WaveSystemsCorp. ArjenLenstra,Citicorp PhilipMacKenzie,LucentBellLabs AviRubin,AT&TLabs-Research JacquesStern,EcoleNormaleSup erieure KazueSako,NEC StuartStubblebine,CertCo PaulSyverson(Chair),NavalResearchLab WinTreese,OpenMarket,Inc. DougTygar,UCBerkeley MichaelWaidner,IBMZurichResearchLab MotiYung,CertCo GeneralChair StuartHaber,Intertrust SponsorshipChair BarbFox,Microsoft FinancialCryptography2001wasorganizedbytheInternationalFinancialCr- tographyAssociation(IFCA),andwassponsoredbyBibitInternetPayments, CertCo,Certicom,HushCommunications,IBM,InterTrustSTARLab,- crosoft,nCipher,RSASecurity,andZero-KnowledgeSystems. TableofContents ManagingPaymentTransactionCosts AmortizedE-Cash . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 MosesLiskov,SilvioMicali O ineMicropaymentswithoutTrustedHardware. . . . . . . . . . . . . . . . . . . . . . 21 MattBlaze,JohnIoannidis,AngelosD. Keromytis Panel(I) ThePracticalProblemsofImplementingMicroMint. . . . . . . . . . . . . . . . . . . . 41 NickovanSomeren ProtectingDigitalRights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 YairFrankel AspectsofDigitalRightsManagementandtheUseofHardwareSecurity Devices. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 DavidW. Kravitz ASolutiontotheNapsterPhenomenon:WhyValueCannotBeCreated AbsenttheTransferofSubjectiveData. . . . . . . . . . . . . . . . . . . . . . .
Language: English
Published by Springer Berlin Heidelberg, Springer Berlin Heidelberg Aug 2002, 2002
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The papers in this volume represent the technical program of the 8th Biennial Workshop on Data Bases and Programming Languages (DBPL 2001), that was held during September 8 10, 2001, in Frascati, located on the beautiful hills surro…unding Rome, in an area favored by the ancient Roman patricians who built their summer residences there. DBPL 2001 continued the tradition of - cellence initiated by its predecessors in Rosco , Finist` ere (1987), Salishan, O- gon (1989), Nafplion, Argolida (1991), Manhattan, New York (1993), Gubbio, Umbria (1995), Estes Park, Colorado (1997), and Kinloch Rannoch, Scotland (1999). Databases grew out of a separation between physical and logical data, thus enabling high-level query languages. Database query languages have evolved in expressive power and structural capabilities. Programming languages have seen a development from assembly languages to high-level declarative paradigms. Thus the two areas approach each other as they mature. Earlier successful cro- fertilizationsbetweenthe eldsincludethecombinationofrelationaltheory,type theory and object-oriented languages, resulting in object-oriented databases, object-relational databases and persistent programming languages. The com- nation of database logic programming and constraint programming p- duceddeductiveandconstraintdatabases.Recently,withtheemergenceofse- structured data models, there is a renewed synergy between databases and p- gramminglanguages,inparticularinthedesignoflanguagestomanipulateXML data. The DBPL 2001 Program Co-Chairs were Giorgio Ghelli (Pisa) and G osta Grahne(Montr eal).TheProgramCommitteeMemberswereCatrielBeeri(Je- salem),DiegoCalvanese(Rome),RichardConnor(Glasgow),AlonHalevy(Se- tle), Leonid Libkin (Toronto), Gianni Mecca (Potenza), Frank Neven (Limburg), Benjamin Pierce (Philadelphia), Chris Ramming (Menlo Park), J er ome Sim eon (Murray Hill), Victor Vianu (San Diego), and Philip Wadler (Basking Ridge). 360 pp. Englisch.
Language: English
Published by Springer Berlin Heidelberg, Springer Aug 2002, 2002
- Softcover
- Print on Demand
Seller: BuchWeltWeit Ludwig Meier e.K., Bergisch Gladbach, GermanyBuchWeltWeit Ludwig Meier e.K.
Contact seller5-star sellerCondition: New
£ 47.24
£ 19.72 shippingShips from Germany to U.S.A.Quantity: 2 available
Taschenbuch. Condition: Neu. This item is printed on demand - it takes 3-4 days longer - Neuware -The Arti cial Intelligence and Cognitive Science Conference has taken place annually since 1988. It provides a forum for the exchange of ideas and the p- sentation of results relating to work conducted both in Ireland and worldwide.… The conference spans a large number of elds including case-based reas- ing, cognitive modeling, constraint processing, data mining, evolutionary c- putation, intelligent agents, intelligent information retrieval, knowledge rep- sentation and reasoning, learning, natural language processing, neural networks, perception and planning, robotics, and scheduling. AICS 2002 was the thirteenth conference in the series and took place at U- versityofLimerickon12 13September.Inadditiontothe16regularpapersand 17 concise papers accepted for presentation, we were delighted to welcome two prestigious keynote speakers both tting in with the conference theme Towards Bio-inspired Computing . They were David Goldberg of University of Illinois at Urbana-Champaign, and Dario Floreano of the Swiss Federal Institute of Te- nology. I would like to take this opportunity to thank our sponsors QAD Ireland and University of Limerick, as well as all those who were involved in the organisation of the conference including the Co-chairs, Programme Committee members, and Conference Administrators. June 2002 Richard F. E. Sutcli e Organisation AICS 2002 was organized by the Department of Computer Science and Inf- mation Systems, University of Limerick, in association with the Arti cial Int- ligence Association of Ireland. 264 pp. Englisch.
